VIP (Vasoactive Intestinal Peptide) 10 mg

Specification

Reagent detail

CAS number	40077-57-4
Molecular formula	C147H238N44O42S
Molecular weight	3325.83 g/mol
Sequence	HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Vial contents	10 mg per vial (nominal fill), lyophilized powder
Storage	Store lyophilized at −20 °C, protected from light and moisture.
Certificate of analysis	Available on request: contact us

Certificate of analysisIndependent third-party identity and purity testing for this compound.

Request COA →

For laboratory and research use only. Not for human consumption.

This product is a research chemical. It is not a drug, food or cosmetic, and it is not for human or veterinary use. It is sold exclusively to qualified researchers and laboratories.

This product has not been evaluated or approved by the U.S. Food and Drug Administration and is not intended to diagnose, treat, cure, or prevent any disease.

Description

Product overview

Vasoactive intestinal peptide (VIP) is a synthetic 28-amino-acid compound supplied for in vitro laboratory research.

Specifications

Form: Lyophilized powder
Container: Sealed glass vial with aluminum tear-off seal
Amounts available: 10 mg
Purity: See the certificate of analysis linked on this page
Storage: Store lyophilized at −20 °C, protected from light and moisture.

Research use only

For laboratory and research use only. Not for human consumption. This product is not a drug, food or cosmetic, and it is not for human or veterinary use. It has not been evaluated or approved by the U.S. Food and Drug Administration and is not intended to diagnose, treat, cure, or prevent any disease.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.